PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010925862.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 1094aa    MW: 120946 Da    PI: 5.0792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010925862.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-1754100148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg WT eEd +l  av+++ g++Wk+Ia++++  Rt+ qc +rwqk+l
   XP_010925862.1  54 RGQWTSEEDAILQTAVQEFKGKNWKKIAECFP-DRTDVQCLHRWQKVL 100
                      89******************************.************986 PP

2Myb_DNA-binding62.39.9e-20106152148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
   XP_010925862.1 106 KGPWTKEEDEKIIEMVNKHGPKKWSTIAQALN-GRIGKQCRERWHNHL 152
                      79******************************.*************97 PP

3Myb_DNA-binding44.53.6e-14158200145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+ E+  l++a++ +G++ W+   + ++ gRt++ +k++w+
   XP_010925862.1 158 KQAWTQKEEIALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 200
                      799*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71149100IPR017930Myb domain
SMARTSM007176.6E-1553102IPR001005SANT/Myb domain
PfamPF002494.6E-1554100IPR001005SANT/Myb domain
SuperFamilySSF466893.16E-1555110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2155111IPR009057Homeodomain-like
CDDcd001672.92E-1357100No hitNo description
PROSITE profilePS5129431.9101156IPR017930Myb domain
SuperFamilySSF466894.87E-31103199IPR009057Homeodomain-like
SMARTSM007171.7E-18105154IPR001005SANT/Myb domain
PfamPF002493.8E-18106152IPR001005SANT/Myb domain
CDDcd001672.82E-16108152No hitNo description
Gene3DG3DSA:1.10.10.601.1E-25112160IPR009057Homeodomain-like
SMARTSM007172.7E-13157205IPR001005SANT/Myb domain
PROSITE profilePS5129418.57157207IPR017930Myb domain
PfamPF002492.7E-12158201IPR001005SANT/Myb domain
CDDcd001673.71E-10160200No hitNo description
Gene3DG3DSA:1.10.10.602.4E-20161207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1094 aa     Download sequence    Send to blast
MMASDWGKGA NKGETSASAS TSASNAVQDV CGDEIQRRRP LHGRTTGPTR RSTRGQWTSE  60
EDAILQTAVQ EFKGKNWKKI AECFPDRTDV QCLHRWQKVL NPELVKGPWT KEEDEKIIEM  120
VNKHGPKKWS TIAQALNGRI GKQCRERWHN HLNPAINKQA WTQKEEIALI HAHQIYGNKW  180
AELTKFLPGR TDNAIKNHWN SSVKKKLDSY LASGLLAQFQ GLPHAENPAQ CISSSVVNQQ  240
NSEDSRIKDR QEVEDSSECS KESSSALVGC SQSDYELAIT VRDDIQLAEA AKKKDIHDSQ  300
LSMCSKDYYA SMEEIECIVP ETQCEPMVSV TAPCQNLHEI EISGRLANQM VSQELPNSLL  360
EAAQRSPELK RTSEYHKNKS LLFPDSGGPK MATCITNSGV ESENHNKISM AEADCCSGSV  420
FGAEMHEDVT MENPITAPNI INMDYYLGSG SSQPDFYGSL AYRNLISCSQ PQYPANSSDM  480
LGNSYCQGLM TVVPPSYICP DDGKPICRSD DAVTRDISVG TQYSELITCM YDGFAYSNCS  540
SLSPSGGSRS KIFVPEDQHK ENETPVQTYM AMMDSEPPNA MDNITSSDEN PAIQTEEHPD  600
AGALFYEPPR FPSLEIPFVS CDLISSGDLQ QAYSPLGIRQ LMMSSTSCSL WDSPSHDESP  660
DALLKSAAKS FICTPSIMKK RQRELLSPLQ ERRIDKKSGI DTDRVLFSTP SISRTDNFSM  720
GIMNDEGVAP RISSCSSEAN ALYPSNHQKK KHEICLEQKE NLDCTPSYQK DEDALVEAKA  780
RISSNESKSS FYQAKKEQCT TAISAPTNLH ANVTENEPPA GVLVEHNTND MLLFSTDQDG  840
HPVNGQIRTA ARSLEDQTFR SFEISPNKGH SDARSEALSD LSGPLSPRVG ESMQEQQQVP  900
VTSAQCALSV HPLEVSVEKH GSLIDMDLEN LNISFADTPG IKRGIESPSA WKSPWFMNSL  960
LPGHRIDTDI TFEDIGYFVS PGDRSYDAIG LMRQLSEHTA SAVAEAQEVL ASGSPGVDFD  1020
KRHSGKENFQ KENIQSDKEL GDHPLTPKVM MEARILDFNA CATPVRKTEN KKIGNIGTSV  1080
NFSSTSSYLM KGYR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-67542076159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-67542076159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010925862.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_010925863.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_010925864.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLM0S9I00.0M0S9I0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P19890_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-152myb domain protein 3r-4